PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004504915.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 175aa    MW: 19558.4 Da    PI: 9.978
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004504915.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.46.5e-17957149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k++ n   r+vtfskR+ng++KKA+ELS+LC+ ++ +  + + g+l+ +
  XP_004504915.1  9 KFVRNRDCRNVTFSKRKNGLIKKASELSILCGSRIGLSGYTPGGNLFAF 57
                    57789999***************************99999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.6E-22160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-20174IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.156161IPR002100Transcription factor, MADS-box
CDDcd001203.42E-23260No hitNo description
PRINTSPR004042.7E-16323IPR002100Transcription factor, MADS-box
PfamPF003196.1E-171157IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGRKKIDIKF VRNRDCRNVT FSKRKNGLIK KASELSILCG SRIGLSGYTP GGNLFAFGSP  60
TFEVVTNEFL NEENYQLGGE SSKQIGGSPQ IGRINELNQR LNDLNQELME KGKDPIDLDA  120
YDFEGLQKVN DSLKVLQSEI DAAASLLALA NRPIQFIKIN HGNKWGKPKL IKIKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mnm_A1e-143681883PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
1mnm_B1e-143681883PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004504915.11e-125PREDICTED: MADS-box transcription factor 23
TrEMBLA0A072UZY52e-45A0A072UZY5_MEDTR; MADS-box transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-24AGAMOUS-like 29